Peptide Synthesis Service ! *** Peptide<>Plasmide<>Proteine<>Antikörper<>einfach<>zuverlässig<>kaufen ***
 +49 (0)711 901818-5

Peptidsynthese & Antikörperherstellungsservice

Genosphere Biotechnologies - Your Experts in High-Quality Peptide Synthesis.

Ihr Customer Synthesis Service für Peptidsynthesen - Gensynthesen (Plasmide, Vektoren) - Proteinexpression - Herstellung polyklonaler und monoklonaler Antikörper.

*** Kauf auf Rechnung *** 100% QC *** Sicherer Versand ***

Wir sind für Sie erreichbar:

Genosphere Biotechnologies - Kundenservice in Deutschland

Telefon: +49 (0)711 901818-5

E-mail : info@genosphere-biotech.de
Internet: www.biomodul.de

Stuttgart, den 12.02.2022

Vos experts en synthèse de peptides de haute qualité.

  • Angebote


    Informationen und Angebote erhalten Sie unter:

    Telefon:+49 (0)711 9018185

    eMail: info@genosphere-biotech.de

  • Kaufen


    Bitte senden Sie uns ihren Auftrag unter Angabe der Angebotsnummer zu:
    Fax: +49 (0)711 9977707

    eMail: Bestellung@genosphere-biotech.de

Antikörperproduktion

Herstellung von affinitätsgereinigten Antikörpern, geeignet für Western Blot und ELISA.

Wir produzieren kundenspezifische monoklonale & polyklonale Antikörper.

Host: Meerschweinchen, Kaninchen, Huhn, Ziege

Leadtime: 3-4 Monate

Antikörperherstellung - Preisliste 2023

Host & Purification method Delivery Leadtime Price (€)
2 rabbits; Affinity chromatography purification. 2-5 mg specific antibodies. Pre-immune sera. Report with ELISA data > 1: 40.000. 2 mg free peptide, purity >90%, LC & MS peptide analysis 3-4 months 1100 €
2 rabbits; total IgG chromatography purification. 15-25 mg total IgG antibodies. Pre-immune sera. Report with ELISA data > 1: 30.000. 2 mg free peptide, purity >90%, LC & MS peptide analysis. 3-4 months 995 €
2 guinea pigs, "crude antisera (lyophilised)" 5-8 ml crude antisera (lyophilised). Pre-immune sera. Report with ELISA data > 1: 20.000. 2 mg free peptide, purity >90%, LC & MS peptide analysis. 3 months 795 €

Peptidsynthese / Peptide Libraries / Arrays

Genosphere Biotechnologies bietet Ihnen die kostengünstige parallele Peptidsynthese von “custom peptide libraries / arrays ” im 96-wells Mikroplattenformat an. Durch die Nutzung einer simultanen Multi-Peptid Synthesetechnologie (Fmoc), sind wir in der Lage auch komplexe Anforderungen zu erfüllen.

Mehr: #Peptidbibliotheken

Advanced Peptide Synthesis Service ** Deuterated Peptides ** Free HPLC/MS/COA Analysis.

Peptide mit Disulfidbrücken

Deslorelin

Peptidname CAS No ; Gegenion: Acetat, Reinheit: >98%, Menge: 200 mg Price (without VAT, netto) **) zzgl. 52€ pro Lieferung. Aufträge mit mehreren Peptiden werden in einer Lieferung zusammengefasst.
Deslorelin CAS No : 57773-65-6 790,20 €
  Bitte fügen Sie bei Ihrer Bestellung die Peptidsequenz, Menge, Reinheit und Preisangabe einfach per copy + paste ein. **) Bei Angabe der USt.-ID Nummer ist der Angebotspreis auch gleich Rechnungsbetrag (netto = brutto).
    ... more API substances available / in stock ...

GLP-1 amide (7-37)

Peptidname CAS No ; AA Sequence Price (without VAT, netto) **) zzgl. 52€ pro Lieferung. Aufträge mit mehreren Peptiden werden in einer Lieferung zusammengefasst.
GLP-1 amide (7-37) chemically synthesized 31-mer peptide ; Acetat salt CAS No : 107444-51-9 AA Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 Amount: 10 mg, Purity: > 95% , Counter ion: Acetat 673,80 €
GLP-1 amide (7-37) chemically synthesized 31-mer peptide ; TFA salt CAS No : 107444-51-9 AA Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 Amount: 10 mg, Purity: > 95% , Counter ion: TFA 449,20 €
  Bitte fügen Sie bei Ihrer Bestellung die Peptidsequenz, Menge, Reinheit und Preisangabe einfach per copy + paste ein. **) Bei Angabe der USt.-ID Nummer ist der Angebotspreis auch gleich Rechnungsbetrag (netto = brutto).
    ... more API substances available / in stock ...
Cosmetic peptides 4U.
Cosmetic peptides 4U. Innovative Forschungspeptide für die Kosmetik - Genosphere Biotechnologies, Paris 2023.


Gene Synthesis Services ** Peptide Synthesis Services ** Protein Expression Services ** Antibodies Production Services


Genosphere Biotechnologies** Kundenservice Deutschland **. Life Sciences Custom Services ***

eMail: info@genosphere-biotech.de *** www.biomodul.de ***

Linz

Isotopenmarkierte Peptide

Vienna

Peptide mit Disulfidbrücken

Ova (257-264)

Peptidname L-AA-Sequenz; Gegenion: TFA, Reinheit: >95%, Menge: 50 mg Price (without VAT, netto) **) zzgl. 52€ pro Lieferung. Aufträge mit mehreren Peptiden werden in einer Lieferung zusammengefasst.
Ova (257-264) SIINFEKL-amide (8-mer) 210,60 €
  Bitte fügen Sie bei Ihrer Bestellung die Peptidsequenz, Menge, Reinheit und Preisangabe einfach per copy + paste ein. **) Bei Angabe der USt.-ID Nummer ist der Angebotspreis auch gleich Rechnungsbetrag (netto = brutto).

MOG (35-55)

Peptidname L-AA-Sequenz; Gegenion: TFA, Reinheit: >95%, Menge: 50 mg Price (without VAT, netto) **) zzgl. 52€ pro Lieferung. Aufträge mit mehreren Peptiden werden in einer Lieferung zusammengefasst.
MOG (35-55) MEVGWYRSPFSRVVHLYRNGK-OH (21-mer) 491,40 €
  Bitte fügen Sie bei Ihrer Bestellung die Peptidsequenz, Menge, Reinheit und Preisangabe einfach per copy + paste ein. **) Bei Angabe der USt.-ID Nummer ist der Angebotspreis auch gleich Rechnungsbetrag (netto = brutto).

Mainz - Plasmid manufacturing

Site directed mutagenesis

Heidelberg - Protein expression

Isotopenmarkierte Peptide

Marburg - Antibodies Production

Huhn, Ratte, Kaninchen ..

Martinsried - SFB 1243

phosphospezifische Antikörper

Informationen und Angebote ...

C6-Spacer, psi Pseudopeptides ..
C6-Spacer, psi Pseudopeptides .. structure-activity studies


... erhalten Sie ganz einfach online !

Nutzen Sie für Ihre Anfragen unser Online Inquiry Formular und bestellen Sie dann über unser Online Order Formular.

Bitte geben Sie bei Ihrer Bestellung, die von uns im Angebot genannte Angebotsnummer an.

Die Bezahlung der Produkte / Projekte erfolgt innerhalb von 14 Tagen nach Erhalt der Ware auf Rechnung.


Für weiterführende Fragen stehen wir Ihnen gerne per email : info@genosphere-biotech.de oder telefonisch unter : 0711 9018185 zur Verfügung.

Magdeburg - SFB/Transregio 31: Das aktive Gehör

Greifswald - SFB/Transregio 34

Zugriffe heute: 1811 - gesamt: 11024.

Wir verwenden Cookies um unsere Website zu optimieren und Ihnen das bestmögliche Online-Erlebnis zu bieten. Mit dem Klick auf "Alle erlauben" erklären Sie sich damit einverstanden. Unsere Datenschutzerklärung können sie davon unabhängig zustimmen oder ablehnen. Erweiterte Einstellungen